Sequence 1: | NP_648895.1 | Gene: | TyrRS / 39829 | FlyBaseID: | FBgn0027080 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021329980.1 | Gene: | mars2 / 566565 | ZFINID: | ZDB-GENE-111201-1 | Length: | 595 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 49/232 - (21%) |
---|---|---|---|
Similarity: | 83/232 - (35%) | Gaps: | 71/232 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ITPAEKKALITRNLQETLGDDKLTKILAERD-LKIYWGTATTGKPHVAYFVPMSKIADFLKAGCE 67
Fly 68 VTILFADLHAYLDNMKAPWS---------LLELRTKYYEQVI---------------------KA 102
Fly 103 MLSSIG---VPLEKL-KF-VKGSDYQLSK----EYTLDVY--KLSSVVTQHDAKKAGAEV----- 151
Fly 152 ----VKQVEYPLLSGLLYPGL----QALDEEYLKVDA 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TyrRS | NP_648895.1 | nt_trans | 8..334 | CDD:294020 | 47/228 (21%) |
tyrS | 12..332 | CDD:272976 | 47/224 (21%) | ||
tRNA_bind_EMAP-II_like | 364..466 | CDD:239198 | |||
mars2 | XP_021329980.1 | PRK12267 | 45..594 | CDD:330948 | 49/232 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |