DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and aimp1

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_012818679.2 Gene:aimp1 / 549804 XenbaseID:XB-GENE-958442 Length:313 Species:Xenopus tropicalis


Alignment Length:191 Identity:81/191 - (42%)
Similarity:116/191 - (60%) Gaps:31/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 AAAYPPPAK-----VKAG-----------------AAPAAGADE----DAPHRLDIRVGKVVEVA 378
            :|..|||.|     .|:|                 ..|||..||    |. .|||:|||.:|...
 Frog   104 SAPQPPPVKSSPPAPKSGEEKKKKEKPEKKGEKKEKKPAASEDEIKAVDV-SRLDLRVGCIVTAK 167

  Fly   379 RHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTS 443
            :|||||:|||.::|:.||.|||::|||||.:..|::..|:..:||||||:|||||||:.||:|.|
 Frog   168 KHPDADSLYVEEVDVGEATPRTVVSGLVKHIPLEQMQNRMAVLLCNLKPAKMRGILSQAMVMCAS 232

  Fly   444 NADHT-VVEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWK 503
            :.:.. :::|   |:.|..|.|::|:|:.|.||::||||||.||::..|..||...:|.:|
 Frog   233 SPEKVEILDP---PSGAVPGDRITFQGYPGEPDKELNPKKKTWEQIQPDLLTNDKCVATYK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020
tyrS 12..332 CDD:272976
tRNA_bind_EMAP-II_like 364..466 CDD:239198 50/102 (49%)
aimp1XP_012818679.2 alaS <31..87 CDD:234701
PLN02610 <142..313 CDD:215329 73/153 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D557463at33208
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.