DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and aimp1

DIOPT Version :10

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_012818679.2 Gene:aimp1 / 549804 XenbaseID:XB-GENE-958442 Length:313 Species:Xenopus tropicalis


Alignment Length:191 Identity:81/191 - (42%)
Similarity:116/191 - (60%) Gaps:31/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 AAAYPPPAK-----VKAG-----------------AAPAAGADE----DAPHRLDIRVGKVVEVA 378
            :|..|||.|     .|:|                 ..|||..||    |. .|||:|||.:|...
 Frog   104 SAPQPPPVKSSPPAPKSGEEKKKKEKPEKKGEKKEKKPAASEDEIKAVDV-SRLDLRVGCIVTAK 167

  Fly   379 RHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTS 443
            :|||||:|||.::|:.||.|||::|||||.:..|::..|:..:||||||:|||||||:.||:|.|
 Frog   168 KHPDADSLYVEEVDVGEATPRTVVSGLVKHIPLEQMQNRMAVLLCNLKPAKMRGILSQAMVMCAS 232

  Fly   444 NADHT-VVEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWK 503
            :.:.. :::|   |:.|..|.|::|:|:.|.||::||||||.||::..|..||...:|.:|
 Frog   233 SPEKVEILDP---PSGAVPGDRITFQGYPGEPDKELNPKKKTWEQIQPDLLTNDKCVATYK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:469580
PLN02610 <366..525 CDD:215329 68/139 (49%)
aimp1XP_012818679.2 CwlO1 3..>81 CDD:443091
PLN02610 <142..313 CDD:215329 73/153 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.