DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and aimp1b

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_021325469.1 Gene:aimp1b / 494049 ZFINID:ZDB-GENE-041212-13 Length:346 Species:Danio rerio


Alignment Length:254 Identity:77/254 - (30%)
Similarity:133/254 - (52%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 VTFLKYED-LEKYYAEDK---LHPGDLKATVEKYINRLLD-PIRKAFENPELQKLSAAAYPPPAK 348
            :.|||.:. |:....|:|   :....||..::...|.|.| ..|||.:..:.:.|||:.....|:
Zfish    72 ILFLKEKAMLQASVREEKKLLVENAKLKKDIDDLKNLLQDTQKRKAVKLRQERALSASIASTSAQ 136

  Fly   349 VKAGA-----APAAGADEDAPH-----------------------------RLDIRVGKVVEVAR 379
            :...|     ||:|.......|                             |||:||.::::|.:
Zfish   137 LGEPAPSTHTAPSATQTHAHTHHDGRRRRERRGVSCESVCVLSREQKLDVSRLDLRVARILDVRK 201

  Fly   380 HPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTSN 444
            |||:::|||.:::|.|..|||::|||...|..|:|...||.:|||::..|:||:.|:..:||..|
Zfish   202 HPDSESLYVQEVELGEHAPRTVVSGLTNHVPPEQLLGSLVVLLCNVRSVKVRGVQSQARLLCAVN 266

  Fly   445 ADHTVVEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWK 503
            .:.  :||:..|..|..|.|::|:.:.|.|:::||||:::||:|..|.:.::.|:|.::
Zfish   267 QER--MEPLTPPTGAQPGDRVTFQLYPGEPEKELNPKQRLWERLLPDLRIDARGVATYR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 14/49 (29%)
tyrS 12..332 CDD:272976 14/47 (30%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 42/130 (32%)
aimp1bXP_021325469.1 PRK12267 <179..346 CDD:330948 54/147 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D557463at33208
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.