DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and MetRS-m

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster


Alignment Length:466 Identity:80/466 - (17%)
Similarity:145/466 - (31%) Gaps:165/466 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWSLLELRTKYYEQ--VIKAMLSSIGV 109
            ||:.:.               .:.:.||.|.....::.|...:.|.|...|.  .|:...|..||
  Fly    33 PHIGHL---------------YSAVIADAHCRYQRLRYPEQDVRLCTGTDEHGTKIQQAASLHGV 82

  Fly   110 PLEKLKFVKGSDY--QLSKEYTLDVYKLSSV-------VTQHDAKKAGAEVVKQVE-----YPLL 160
            |:.|        |  .:|:.|. :|::.:|:       .|:...|:|.|...:.:.     |   
  Fly    83 PVAK--------YCDDISQRYR-EVFRSASIQQDDFIRTTEDRHKRAVANFWRTLHTRGHIY--- 135

  Fly   161 SGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSS 225
             ...|.|...:.:|....|:|. .:|:.....:|.:....:.:.:..::|         .::|..
  Fly   136 -SAAYSGWYCVSDETFLTDSQL-RLDEATGTRYSLESGHPVEWTEETNYM---------FRLSQF 189

  Fly   226 EED----SKIDLLDSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHG 286
            ::|    .|.:....||..:|.|.....||                                   
  Fly   190 QDDVRHWVKTEARVRPAKFEKILLDTLSEP----------------------------------- 219

  Fly   287 GDVTFLKYEDLEKYYAEDKLH-----PGDLKATVEKYINRLLDPIRKAFENPELQKLSAAAYP-- 344
                   ..|:......:::|     |.|...||..:::.|::            .||:..||  
  Fly   220 -------LPDVSVSRPSNRVHWAIPVPDDDSQTVYVWLDALVN------------YLSSVGYPDE 265

  Fly   345 ------PPAKVKAG-----------AAPAAGADEDAPHRLDIRV-----GKVVEVARHPDADTLY 387
                  |||:...|           .|....|..:.|.:|.:..     |:.:..::|...|.| 
  Fly   266 KFSAHWPPAQQVIGKDILKFHGIYWTAFLLAAGLEPPGQLYVHSHWTVDGQKMSKSKHNVVDPL- 329

  Fly   388 VLKIDLAEAQPRTIISGLVKFVTEEE----------------LNQRLVAVLCNLKPSKMRGILSE 436
                   :|..:..:.||..|:..|.                ||..|...|.||........|:.
  Fly   330 -------QAAQQYTMEGLRYFLLREGVAHSDGNYSHVKAQRILNSELADTLGNLLSRASAKSLNP 387

  Fly   437 GMVLCTSNADH 447
            |.:..:.:|:|
  Fly   388 GQIYPSPSAEH 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 49/311 (16%)
tyrS 12..332 CDD:272976 49/309 (16%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 21/105 (20%)
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907 70/422 (17%)
PRK11893 21..553 CDD:237012 80/466 (17%)
Anticodon_Ia_like 365..503 CDD:299868 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.