DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and Y105E8A.28

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001364633.1 Gene:Y105E8A.28 / 3565614 WormBaseID:WBGene00013685 Length:225 Species:Caenorhabditis elegans


Alignment Length:184 Identity:34/184 - (18%)
Similarity:56/184 - (30%) Gaps:67/184 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 DVTFLKYEDLEKY--------YAEDKLHPGDLKATVEKYINRL--------LDPIRKAFENPELQ 336
            ::..|:.|:|.::        .||:.....|:...|.:. |||        |.|.|:....|. |
 Worm    48 NIRHLRNEELHRFRQAVPPPQQAEEAEEEADVAENVVEQ-NRLGPIRRGQFLGPRRRLLFQPN-Q 110

  Fly   337 KLSAAAY-------------------------------PPPAKVKAGAAPAAGADEDAPHRLDIR 370
            :|.....                               |||...:..||....|:..:|...:..
 Worm   111 RLCRVGEHRDGIAPNLLRHQAFVPQVAPLAGPQPFVPPPPPPLPEPAAAAERNAENASPSEEEGP 175

  Fly   371 VGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCN 424
            :|.:     .|...|:        |.:|..:..||.     |||:......:.|
 Worm   176 IGPI-----EPPRITM--------EVEPVNVTFGLT-----EELDDSCSTAILN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 13/61 (21%)
tyrS 12..332 CDD:272976 13/59 (22%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 12/61 (20%)
Y105E8A.28NP_001364633.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.