Sequence 1: | NP_648895.1 | Gene: | TyrRS / 39829 | FlyBaseID: | FBgn0027080 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956370.1 | Gene: | mars1 / 338183 | ZFINID: | ZDB-GENE-030219-83 | Length: | 922 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 46/202 - (22%) |
---|---|---|---|
Similarity: | 69/202 - (34%) | Gaps: | 72/202 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 VEKYINRLLDPIR-----------KAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLD 368
Fly 369 IRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGI 433
Fly 434 LS-EGMVLCTSNADHTV--VEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVW-----EKLSA 490
Fly 491 DFKTNSD 497 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TyrRS | NP_648895.1 | nt_trans | 8..334 | CDD:294020 | 7/29 (24%) |
tyrS | 12..332 | CDD:272976 | 6/27 (22%) | ||
tRNA_bind_EMAP-II_like | 364..466 | CDD:239198 | 21/104 (20%) | ||
mars1 | NP_956370.1 | GstA | 1..173 | CDD:223698 | |
GST_N_family | 1..67 | CDD:238319 | |||
GST_C_MetRS_N | 75..176 | CDD:198340 | |||
PRK12268 | 261..820 | CDD:237029 | 40/185 (22%) | ||
MetRS_core | 263..631 | CDD:173907 | |||
Anticodon_Ia_Met | 640..769 | CDD:153411 | 23/113 (20%) | ||
MetRS_RNA | 866..910 | CDD:238475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |