DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrRS and mars1

DIOPT Version :9

Sequence 1:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio


Alignment Length:202 Identity:46/202 - (22%)
Similarity:69/202 - (34%) Gaps:72/202 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VEKYINRLLDPIR-----------KAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLD 368
            :::|| :|||.:|           ....|..:|     ...|..|:|.||       ||.     
Zfish   687 LKQYI-QLLDKVRIRDALKCILNMSRHGNQYIQ-----LNEPWKKIKGGA-------EDR----- 733

  Fly   369 IRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGI 433
            .|.|.|..|:    .:...:|...|....|...:|          :..:|.|     ..|..|.:
Zfish   734 CRAGTVTGVS----VNVACLLAAVLEPFMPTVSLS----------IRSQLQA-----PESSSRAM 779

  Fly   434 LS-EGMVLCTSNADHTV--VEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVW-----EKLSA 490
            || .|..:||..|.|.:  |.|:                |....:||:...:|.:     |:.||
Zfish   780 LSGPGAFICTLPAGHRIGTVSPL----------------FQKLENEQIEALRKRFGGLQPEEESA 828

  Fly   491 DFKTNSD 497
            ..||.|:
Zfish   829 GLKTPSN 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 7/29 (24%)
tyrS 12..332 CDD:272976 6/27 (22%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 21/104 (20%)
mars1NP_956370.1 GstA 1..173 CDD:223698
GST_N_family 1..67 CDD:238319
GST_C_MetRS_N 75..176 CDD:198340
PRK12268 261..820 CDD:237029 40/185 (22%)
MetRS_core 263..631 CDD:173907
Anticodon_Ia_Met 640..769 CDD:153411 23/113 (20%)
MetRS_RNA 866..910 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.