Sequence 1: | NP_648895.1 | Gene: | TyrRS / 39829 | FlyBaseID: | FBgn0027080 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003750747.1 | Gene: | Mars2 / 100911305 | RGDID: | 1311527 | Length: | 586 | Species: | Rattus norvegicus |
Alignment Length: | 241 | Identity: | 45/241 - (18%) |
---|---|---|---|
Similarity: | 84/241 - (34%) | Gaps: | 85/241 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ITPAEKKALITRNLQETLGDDKLTKILAERDLKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEV 68
Fly 69 TILFADLHAYLD-NMKAPW---------SLLELRTKYYEQVIKAMLSSIGV-PLEKLKF-----V 117
Fly 118 KGSDYQLSK-------------EYTLDVYK---LSSVVTQHDAKKAGAEVVKQVE---------- 156
Fly 157 ----------------------YPLLSGLLYPGLQALDEEYLKVDA 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TyrRS | NP_648895.1 | nt_trans | 8..334 | CDD:294020 | 42/237 (18%) |
tyrS | 12..332 | CDD:272976 | 42/233 (18%) | ||
tRNA_bind_EMAP-II_like | 364..466 | CDD:239198 | |||
Mars2 | XP_003750747.1 | MetRS_core | 37..379 | CDD:173907 | 34/173 (20%) |
PRK11893 | 39..574 | CDD:237012 | 45/241 (19%) | ||
Anticodon_Ia_Met | 388..532 | CDD:153411 | 8/58 (14%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |