DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRS-m and GLN4

DIOPT Version :9

Sequence 1:NP_648894.2 Gene:GluRS-m / 39828 FlyBaseID:FBgn0036629 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_014811.3 Gene:GLN4 / 854339 SGDID:S000005694 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:97/391 - (24%)
Similarity:154/391 - (39%) Gaps:90/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NPRM---LMQQCLRHAHSQVRVRFAPSPTGYLHLGGLRTALYNFLYARHLGGKFLLRIEDTDQTR 66
            ||:.   ||::.|.....:||.||.|.|.||||:|..:..:.||.||::..|...||.:||:..:
Yeast   233 NPQAYPELMKEHLEVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEK 297

  Fly    67 LVPGASERLVEDLLWAGIEIDEGPGFGGQLGP----YVQSQRTEIYSKAIEELLHNGTAYRCFCT 127
            ..|...|.:...:.|.|.:            |    |......|:|..| |.|:.||.||.|.||
Yeast   298 EAPEYFESIKRMVSWLGFK------------PWKITYSSDYFDELYRLA-EVLIKNGKAYVCHCT 349

  Fly   128 ERRLDLLRKEALRTRQVP---RYDNKCRHLTTSEVDSLLA---------KGTPYCIRFK--LTDH 178
            ..  ::.|...::....|   ||  .|:|...|...:|..         |.....:|.|  |...
Yeast   350 AE--EIKRGRGIKEDGTPGGERY--ACKHRDQSIEQNLQEFRDMRDGKYKPGEAILRMKQDLNSP 410

  Fly   179 EEPLDDLIYGKVHHNVSDNEGDPVVMKSDQFPTYHFANVVDDHLMGITHVLRGVEWQISTTKHLL 243
            ...:.|||..:|.:......|    .|...:|||.|.:.:.|.:..|||       .:.||:..|
Yeast   411 SPQMWDLIAYRVLNAPHPRTG----TKWRIYPTYDFTHCLVDSMENITH-------SLCTTEFYL 464

  Fly   244 LYKAFGW--------QPP--KFGHLPLLVNADGTKLSKRQ-------------GD---IGIQHFR 282
            ..:::.|        :|.  ::|.|    |..||.||||:             .|   ..::..|
Yeast   465 SRESYEWLCDQVHVFRPAQREYGRL----NITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIR 525

  Fly   283 ERGYFPQALVNYVVSAGGGFEHRTNAKQQLLSMQALHEQFHIERVNSHPSRLNPELLDDLNRLEI 347
            .||..|.|:::::.:.|        ......::|.:..:   ..|..:.....|.|:..|:.:|:
Yeast   526 RRGVPPGAILSFINTLG--------VTTSTTNIQVVRFE---SAVRKYLEDTTPRLMFVLDPVEV 579

  Fly   348 V 348
            |
Yeast   580 V 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRS-mNP_648894.2 gltX 19..500 CDD:234953 92/374 (25%)
GluRS_core 21..349 CDD:173905 92/372 (25%)
Ribosomal_L7_L12 <442..503 CDD:305167
GLN4NP_014811.3 tRNA_synt_1c_R1 5..163 CDD:398315
tRNA_synt_1c_R2 166..244 CDD:398314 4/10 (40%)
glnS 252..807 CDD:273079 92/372 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.