powered by:
Protein Alignment GluRS-m and RPL39
DIOPT Version :9
Sequence 1: | NP_648894.2 |
Gene: | GluRS-m / 39828 |
FlyBaseID: | FBgn0036629 |
Length: | 511 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012346.1 |
Gene: | RPL39 / 853250 |
SGDID: | S000003725 |
Length: | 51 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 41 |
Identity: | 10/41 - (24%) |
Similarity: | 19/41 - (46%) |
Gaps: | 8/41 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 AYRCFCTERRLDLLRKE--------ALRTRQVPRYDNKCRH 153
|.:.|..::::...:|: .|||....||:.|.|:
Yeast 3 AQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRN 43
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0008 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.