DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRS-m and Ears2l1

DIOPT Version :9

Sequence 1:NP_648894.2 Gene:GluRS-m / 39828 FlyBaseID:FBgn0036629 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_008758578.3 Gene:Ears2l1 / 685245 RGDID:1596451 Length:515 Species:Rattus norvegicus


Alignment Length:498 Identity:236/498 - (47%)
Similarity:322/498 - (64%) Gaps:31/498 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VRVRFAPSPTGYLHLGGLRTALYNFLYARHLGGKFLLRIEDTDQTRLVPGASERLVEDLLWAGIE 85
            |||||||||||:||||||||||||:::|:.....|:||:|||||:||||||:|.:.:.|.||||.
  Rat    29 VRVRFAPSPTGFLHLGGLRTALYNYIFAKKHQESFILRLEDTDQSRLVPGAAENIEDMLEWAGIP 93

  Fly    86 IDEGPGFGGQLGPYVQSQRTEIYSKAIEELLHNGTAYRCFCTERRLDLLRKEALRTRQVPRYDNK 150
            .||.|..||..|||.||||..:|::|.|.||.:|.||.|||:.:||:||:|||||:||.|||||:
  Rat    94 PDESPRRGGPAGPYYQSQRLALYAQATEALLKSGAAYPCFCSPQRLELLKKEALRSRQTPRYDNR 158

  Fly   151 CRHLTTSEVDSLLAKGTPYCIRFKLTDHEEPLDDLIYGKVHHNVSDNEGDPVVMKSDQFPTYHFA 215
            ||:|:.::|...||......|||:|.:......||:||...|.|:..|||||::|||.|||||.|
  Rat   159 CRNLSQAQVAQKLATDPKPAIRFRLEEAVPAFQDLVYGWTQHEVASVEGDPVILKSDGFPTYHLA 223

  Fly   216 NVVDDHLMGITHVLRGVEWQISTTKHLLLYKAFGWQPPKFGHLPLLVNADGTKLSKRQGDIGIQH 280
            .|||||.|.|:|||||.||.:||:||||||:|.|||||:|.|||||:|.||:|||||||||.::|
  Rat   224 CVVDDHHMSISHVLRGSEWLVSTSKHLLLYQALGWQPPQFAHLPLLLNRDGSKLSKRQGDIFLEH 288

  Fly   281 FRERGYFPQALVNYVVSAGGGFEHRTNAKQQL-LSMQALHEQFHIERVNSHPSRLNPELLDDLNR 344
            |...|:.|:||::.:.:.|.||     |:.|: .::..|..||.:.|:..|.:.|:.|.|.:.||
  Rat   289 FAATGFLPEALLDIITNCGSGF-----AENQMGRTLPELITQFDLTRITCHSALLDLEKLPEFNR 348

  Fly   345 LEIVQRLSGNESRTKLVNEVQQLVKEAYPQHSNLDLAEEHILD------VLNWSSKRLTLLQDLT 403
            |.:.:.:|....|..||.::|.|||||:    ..:|.:..:||      :|......::.||||.
  Rat   349 LHLRRLVSSETQRPHLVEKLQGLVKEAF----GSELQDRDVLDPAYMERILLLRQGHISRLQDLV 409

  Fly   404 SSKLSFLWVKPSDFQIK--------DLTAEQLAHLLQL--INAIQDFHKDELNVKLKSFAQ-KEN 457
            |...|:||.:|:..:.:        |:.|:.|..||:.  ::..||.    :|.:||..:: .|.
  Rat   410 SPVYSYLWTRPAVHRAELGASSEKLDVIAKHLLGLLERPGLSLTQDV----VNRELKKLSEGLEG 470

  Fly   458 IKFPLMMKTLRAALSGLKEGPGVAEMMEILGKSVTLERLKEAL 500
            .|...:||.||.||||..:||.|||||..||.....||:::.|
  Rat   471 TKHSSVMKLLRMALSGQLQGPPVAEMMVSLGPEEVRERIQKVL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRS-mNP_648894.2 gltX 19..500 CDD:234953 235/496 (47%)
GluRS_core 21..349 CDD:173905 181/328 (55%)
Ribosomal_L7_L12 <442..503 CDD:305167 25/60 (42%)
Ears2l1XP_008758578.3 gltX 28..513 CDD:234953 235/496 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6907
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.