DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRS-m and GlnRS

DIOPT Version :9

Sequence 1:NP_648894.2 Gene:GluRS-m / 39828 FlyBaseID:FBgn0036629 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_524841.1 Gene:GlnRS / 45786 FlyBaseID:FBgn0027090 Length:778 Species:Drosophila melanogaster


Alignment Length:533 Identity:114/533 - (21%)
Similarity:193/533 - (36%) Gaps:147/533 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMQQCLRHAHSQVRVRFAPSPTGYLHLGGLRTALYNFLYARHLGGKFLLRIEDTDQTRLVPGASE 73
            |:::.|.....:|..||.|.|.|.||:|..:....||.||....|...||.:||:        .|
  Fly   255 LLKEHLARTGGKVHTRFPPEPNGILHIGHAKAININFGYAAAHDGVCYLRYDDTN--------PE 311

  Fly    74 RLVEDLLWAGIEIDEGPGFGGQLGPYVQSQRTEIYSKAIEELLHNGTAYRCFCTERRLDLLRKEA 138
            :..|....|..|:.|..|:......|......::|..|: .|::.|.||.|              
  Fly   312 KEEEKFFLAIKEMVEWLGYKPFKITYSSDNFQQLYEWAV-VLINKGLAYVC-------------- 361

  Fly   139 LRTRQVPRYDNKCRHLTTSEVDSLLAKGTPYCIRFKLTDHEEPL-------DDLIYGKVHH---- 192
                          |....|:.....|.:|:        .|.|:       :|:..||:..    
  Fly   362 --------------HQKAEELKGFNPKPSPW--------RERPIEESLRLFEDMKRGKIDEGAAT 404

  Fly   193 ---NVSDNEG--DPVVMK----------SDQ--FPTYHFANVVDDHLMGITHVLRGVEWQISTTK 240
               .|:..||  |||..:          ||.  :|||.:.:.:.|.|..|||.|...|:|...:.
  Fly   405 LRMKVTLEEGKMDPVAYRIKFISHHRTGSDWCIYPTYDYTHCLCDSLEDITHSLCTKEFQSRRSS 469

  Fly   241 HLLLYKAFGWQPP---KFGHLPLLVNADGTKLSKRQGDIGIQHFRERGYFPQALVNYVVSAGGGF 302
            :..|..|.|...|   ::|.|    |.:...:|||:             ..:.:...:|      
  Fly   470 YYWLCNALGIYCPVQWEYGRL----NMNYALVSKRK-------------IAKLITEQIV------ 511

  Fly   303 EHRTNAKQQLLSMQALHEQ-FHIERVNSHPSRLNPELLDDLNRLEIVQRLSGNESRTKLVNEVQQ 366
             |..: ..:|.::.||..: |..|.:|:..:::.                         |...|.
  Fly   512 -HDWD-DPRLFTLTALRRRGFPAEAINNFCAQMG-------------------------VTGAQI 549

  Fly   367 LVKEAYPQHSNLDLAEEHILDVLNWSS-KRLTLLQDLTSSKLSFLWVKPSDFQIKDL--TAEQLA 428
            .|..|        :.|..:.||||.:: :||.:|:.|..:..:|....|...::.|.  ..:|..
  Fly   550 AVDPA--------MLEAAVRDVLNVTAPRRLVVLEPLKVTIKNFPHAAPVQLEVPDFPQNPQQGT 606

  Fly   429 HLLQLINAIQ----DFHKDELNVKLKSFAQKENIKFPLMMKTLRAALSGLKEGPGVAEMMEILGK 489
            |.:.|...|.    || |.|.....:..|.|:::  .|....|..::..:.:.|...:::|::..
  Fly   607 HKITLDKVIYIEQGDF-KLEPEKGYRRLAPKQSV--GLRHAGLVISVDEIVKDPATGQVVELICT 668

  Fly   490 SVTLERLKEALPK 502
            |...|:.::  ||
  Fly   669 SQPAEQAEK--PK 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRS-mNP_648894.2 gltX 19..500 CDD:234953 110/519 (21%)
GluRS_core 21..349 CDD:173905 78/359 (22%)
Ribosomal_L7_L12 <442..503 CDD:305167 12/61 (20%)
GlnRSNP_524841.1 PLN02859 10..777 CDD:178450 114/533 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.