DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRS-m and RpL39

DIOPT Version :10

Sequence 1:NP_648894.2 Gene:GluRS-m / 39828 FlyBaseID:FBgn0036629 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:19/41 - (46%) Gaps:8/41 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AYRCFCTERRLDLLRKE--------ALRTRQVPRYDNKCRH 153
            |::.|..:::|....|:        .|||....||:.|.||
  Fly     3 AHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRH 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRS-mNP_648894.2 GlnS 19..500 CDD:439779 12/41 (29%)
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:425894 8/24 (33%)

Return to query results.
Submit another query.