DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRS-m and RpL39

DIOPT Version :9

Sequence 1:NP_648894.2 Gene:GluRS-m / 39828 FlyBaseID:FBgn0036629 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:19/41 - (46%) Gaps:8/41 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AYRCFCTERRLDLLRKE--------ALRTRQVPRYDNKCRH 153
            |::.|..:::|....|:        .|||....||:.|.||
  Fly     3 AHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRH 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRS-mNP_648894.2 gltX 19..500 CDD:234953 12/41 (29%)
GluRS_core 21..349 CDD:173905 12/41 (29%)
Ribosomal_L7_L12 <442..503 CDD:305167
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:395670 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.