DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and FAXC

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_115900.1 Gene:FAXC / 84553 HGNCID:20742 Length:409 Species:Homo sapiens


Alignment Length:303 Identity:90/303 - (29%)
Similarity:146/303 - (48%) Gaps:39/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KDIIYLYQFSR-TPLLPSLSPYCLKVETWLRLVGLKYEN-VDHKMRFRSKKGQLPFIELNGEEIA 165
            ||.|.|:||:| ...:|||||:|||:||:||:..|.|:| ...|:   |.:|::|:||.|.|:::
Human    97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL---SAQGKMPWIEYNHEKVS 158

  Fly   166 DSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQH 230
            .:..||..|..|....|:..|...:|.:|.|...|:|.|..|.:.|  .::.||:.:..|: |..
Human   159 GTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAY--CQWVDNLNETRKM-LSL 220

  Fly   231 ALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFF 295
            :.|....|.:......||.|..    .:::..||||..|.|||....:.|::.|:.:|..|.:..
Human   221 SGGGPFSNLLRWVVCHITKGIV----KREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIM 281

  Fly   296 GDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDW--DEICTKLD 358
            |.:.:|||...|..|:|..:.... ..|.| .:..:..||..:..|::.|.:|:|  |:..|.. 
Human   282 GPKLSTLDATVFGHLAQAMWTLPG-TRPER-LIKGELINLAMYCERIRRKFWPEWHHDDDNTIY- 343

  Fly   359 LNAHIPKPEPETKEGKEGGE------------QEKSNEQEGTE 389
                      |::|..||.:            :.::.|.||.|
Human   344 ----------ESEESSEGSKTHTPLLDFSFYSRTETFEDEGAE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 32/75 (43%)
GST_C_Metaxin <272..343 CDD:198302 18/70 (26%)
FAXCNP_115900.1 GST_N_4 117..212 CDD:379936 35/99 (35%)
GST_C_6 263..326 CDD:379935 15/64 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..409 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159095
Domainoid 1 1.000 61 1.000 Domainoid score I10549
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4996
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D1180930at2759
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 1 1.000 - - oto89550
orthoMCL 1 0.900 - - OOG6_103089
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4319
SonicParanoid 1 1.000 - - X3312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.