DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and Faxc

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_780443.2 Gene:Faxc / 76132 MGIID:1923382 Length:409 Species:Mus musculus


Alignment Length:303 Identity:91/303 - (30%)
Similarity:146/303 - (48%) Gaps:39/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KDIIYLYQFSR-TPLLPSLSPYCLKVETWLRLVGLKYEN-VDHKMRFRSKKGQLPFIELNGEEIA 165
            ||.|.|:||:| ...:|||||:|||:||:||:..|.|:| ...|:   |.:|::|:||.|.|:::
Mouse    97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL---SAQGKMPWIEYNNEKVS 158

  Fly   166 DSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQH 230
            .:..||..|..|....|:..|...:|.||.|...|:|.|..|.:.|  .::.||:.:..|: |..
Mouse   159 GTEFIIDFLEEKLGVNLNKSLGPHERAVSRAVTKMVEEHFYWTLAY--CQWVDNLNETRKM-LSL 220

  Fly   231 ALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFF 295
            :.|....|.:......||.|..    .:::..||||..|.|||....:.|::.|:.:|..|.:..
Mouse   221 SGGGPFSNLLRWVVCHITKGIV----KREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIM 281

  Fly   296 GDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDW--DEICTKLD 358
            |.:.:|||...|..|:|..:.... ..|.| .:..:..||..:..|::.|.:|:|  |:..|.. 
Mouse   282 GPKLSTLDATVFGHLAQAMWTLPG-TRPER-LIKGELINLAMYCERIRRKFWPEWHHDDDNTIY- 343

  Fly   359 LNAHIPKPEPETKEGKEGGE------------QEKSNEQEGTE 389
                      |::|..||.:            :.::.|.||.|
Mouse   344 ----------ESEESSEGSKTHTPMLDFSFYSRTETFEDEGAE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 32/75 (43%)
GST_C_Metaxin <272..343 CDD:198302 18/70 (26%)
FaxcNP_780443.2 GST_N_Metaxin_like 99..172 CDD:239378 32/75 (43%)
GST_C_Metaxin 187..327 CDD:198302 40/148 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..393 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849467
Domainoid 1 1.000 62 1.000 Domainoid score I10361
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4960
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 1 1.000 - - oto93117
orthoMCL 1 0.900 - - OOG6_103089
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4319
SonicParanoid 1 1.000 - - X3312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.690

Return to query results.
Submit another query.