DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and CG9393

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster


Alignment Length:257 Identity:56/257 - (21%)
Similarity:106/257 - (41%) Gaps:38/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFIELNGEEIADSAIIIK 172
            ||.:.....|||:...||:....||......:........||..|:||::::..::.|....|.:
  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKR 73

  Fly   173 ELSSKYEKY-LDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKY-------PDNVLKGYKVNLQ 229
            .|.  .|.| :|:.|:.:|:::|.|       :..|:.....|.|       |.|    :....:
  Fly    74 VLD--LEGYPIDAHLSTKQKHLSTA-------YANWVFTNLHAYYHYFLFGEPHN----FDTTTR 125

  Fly   230 HALGLRLPNSILNFFFKITFGRK---------WFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLS 285
            .....|.|.. .||::..::.|:         .|....||..     |..:.:....|..:.:||
  Fly   126 GLYAKRTPFP-FNFYYPSSYQREACDVVQVMAGFDVNDKLDK-----HEGDYLVVNAKKVVNLLS 184

  Fly   286 EMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCF 347
            ..|..|.:||||..:..|.:.::.|:.:..::.. ..||:::: :.|.||:..::|:....|
  Fly   185 RKLGRKVWFFGDTYSEFDAIVYSYLAIIFKIALP-NNPLQNHI-KGCQNLVNFINRITKDIF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 17/70 (24%)
GST_C_Metaxin <272..343 CDD:198302 17/70 (24%)
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 17/71 (24%)
GST_C_Metaxin1_3 108..244 CDD:198321 29/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.