DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and CG8004

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_649161.1 Gene:CG8004 / 40178 FlyBaseID:FBgn0036920 Length:269 Species:Drosophila melanogaster


Alignment Length:262 Identity:54/262 - (20%)
Similarity:96/262 - (36%) Gaps:83/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LYQ-FSRTPLLPSLSPYCLKVETWLRLVGLKY-----ENVDHKMRFRSKKGQLPFIELNGEEIAD 166
            ||| :....:|...:..||.|:.:|::..|.:     .|.:| |....:..:||||.......|:
  Fly    26 LYQPYEAEQILLPENASCLAVKAYLKMCNLPFLIRSCANAEH-MSPGGRMTKLPFIRAGAFIFAE 89

  Fly   167 SAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHL----IWIIF-----YWRAKYPDNVLK 222
            ...|:..:..| |..:.|....:::......::::||..    ::|.|     |.....|.|   
  Fly    90 FEPIVNFVEQK-ELAIGSWQDEDEKADMRTYVSLVENIFTMAELYISFKNERVYKEVTAPRN--- 150

  Fly   223 GYKVNLQHALGLRLP---NSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVL 284
                      |:..|   |.:.|:            |.::        ::...::.:..|||.:.
  Fly   151 ----------GVVFPWPLNHMQNY------------GKRR--------NALRLLKVYQWDDLDID 185

  Fly   285 S---------EMLDCK-------PFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCP 333
            |         |.|:.|       |||:||:|..||.:||..|..:              :|...|
  Fly   186 SVIDKVAKCCETLEYKLKESPETPFFYGDQPCELDAIAFGHLFSI--------------LTTTLP 236

  Fly   334 NL 335
            |:
  Fly   237 NM 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 19/76 (25%)
GST_C_Metaxin <272..343 CDD:198302 21/80 (26%)
CG8004NP_649161.1 GST_N_Metaxin2 24..100 CDD:239377 18/74 (24%)
GST_C_Metaxin2 130..258 CDD:198320 31/156 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.