DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and cdr-3

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_506115.2 Gene:cdr-3 / 183780 WormBaseID:WBGene00008297 Length:278 Species:Caenorhabditis elegans


Alignment Length:258 Identity:78/258 - (30%)
Similarity:126/258 - (48%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HKTNFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFIELNG 161
            :|.::.:..:|||||.||...|:|||:|:|||...|...:.||..|.|:.: |:.|.||||||||
 Worm    37 YKKDYNRGTVYLYQFKRTKKCPNLSPFCMKVEVLCRAYKVPYEICDEKLIW-SRNGTLPFIELNG 100

  Fly   162 EEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKV 226
            |.|||:.:|...|.   |.:..|.|..|:...|.|...:.:|||..::.  |.|..||   .:..
 Worm   101 EHIADTDLIEVRLR---EHFNISSLPKEKEAQSVAITRLADNHLFNVLL--RYKTSDN---DFYY 157

  Fly   227 NLQHALGL-RLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDC 290
            .|...:|: ::...|...|.|..|.:|.::.:.:    .||.....::::....||:.:.:.|..
 Worm   158 TLLGNMGVPKILQPICLPFIKAAFVKKAYERSTR----AIGDFEQTDLDDILHRDLQTIQDYLGE 218

  Fly   291 KPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLR----DYMTEKCPNLIGHVSRMKDKCFPD 349
            :.|.||||....|...|..|:       .:.||.|    |.:....|.|:.:..|::.:.:|:
 Worm   219 QKFLFGDEVKAADAAVFGQLA-------TVIYPFRCKINDILENDFPQLLEYCERVRKEIYPN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 36/73 (49%)
GST_C_Metaxin <272..343 CDD:198302 18/74 (24%)
cdr-3NP_506115.2 GST_N_Metaxin_like 46..117 CDD:239378 37/74 (50%)
GST_C_Metaxin <200..268 CDD:198302 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D423688at33208
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.