DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and cdr-2

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_506114.1 Gene:cdr-2 / 183779 WormBaseID:WBGene00008296 Length:278 Species:Caenorhabditis elegans


Alignment Length:269 Identity:79/269 - (29%)
Similarity:128/269 - (47%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KFNVHKTNFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFI 157
            |...:|.:::||.:|||||.||...|:|||:|:|||...|...:.||..|.|:|: |:.|.:|||
 Worm    33 KPEAYKKDYKKDTVYLYQFKRTRKCPNLSPFCIKVEILCRAYNIPYEICDDKLRW-SRNGSIPFI 96

  Fly   158 ELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLK 222
            |||||.|||:.:|...|...:.   ...|.|.|...|.|...:.:|||.            |:|.
 Worm    97 ELNGEHIADTDLIEMRLRRHFN---IPSLPAAQEAHSVALTRLADNHLF------------NLLI 146

  Fly   223 GYKV---NLQHAL--GLRLPNSILNFFF---KITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKD 279
            .||:   ...|.|  .:.:|..:....|   :.:||:|.:|.:    ...||....:|:::....
 Worm   147 RYKIIGDEFFHILVRSIGIPKFLQPLLFPLIRASFGKKVYQRS----TGSIGDFELKEMDDILHR 207

  Fly   280 DLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLR----DYMTEKCPNLIGHVS 340
            |.:.:.:.|..:.|.|||:.|..|...|..::       .:.||.|    |.:....|.::.:..
 Worm   208 DFQTIQDYLGDQKFLFGDKVTAADAAVFGQIA-------SVIYPFRCSINDALENDFPKILEYCE 265

  Fly   341 RMKDKCFPD 349
            |::.:.:|:
 Worm   266 RVRQEIYPN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 36/73 (49%)
GST_C_Metaxin <272..343 CDD:198302 16/74 (22%)
cdr-2NP_506114.1 GST_N_Metaxin_like 46..117 CDD:239378 36/71 (51%)
GstA 59..269 CDD:223698 66/236 (28%)
GST_C_Metaxin 198..268 CDD:198302 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D1180930at2759
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.