DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and cdr-1

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_506986.1 Gene:cdr-1 / 180064 WormBaseID:WBGene00000412 Length:277 Species:Caenorhabditis elegans


Alignment Length:270 Identity:81/270 - (30%)
Similarity:131/270 - (48%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KFNVHKTNFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFI 157
            |.::||.:::||::||||..|....|:|||:|:|:|...|:..:.||.:..... ||:.|.:||:
 Worm    32 KPDIHKKDYKKDVVYLYQMKRLKNCPNLSPFCMKIEILCRIFKIPYEIITCTSE-RSRNGLVPFV 95

  Fly   158 ELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLK 222
            |||||.||||.:|...|.|.::   ...|..|....|.|.....::||.:::.    ::...|.:
 Worm    96 ELNGEHIADSDLIEMRLRSHFK---IPSLPTELETQSVALSKFADHHLFFVLI----RFKIAVDE 153

  Fly   223 GYKVNLQHALGLRLPNSILNF----FFKITFGRKWFQGTKKLKAHG-IGVHSAEEIEEFGKDDLK 282
            .||..:: .:||   .:.|||    ..|...|:..:.     |..| ||.....|::|....||:
 Worm   154 FYKTIIE-IIGL---PTFLNFLLMPLLKAIIGKNVYN-----KCQGAIGDFELSELDEILHRDLR 209

  Fly   283 VLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCF 347
            ::...|..|.|.||:|.|..|...|:.|:.::       ||.|:           |:|.:.:|.|
 Worm   210 IVENTLAKKKFLFGEEITAADATVFSQLATVY-------YPFRN-----------HISDVLEKDF 256

  Fly   348 PDWDEICTKL 357
            |...|.|.::
 Worm   257 PKLLEYCERV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 32/73 (44%)
GST_C_Metaxin <272..343 CDD:198302 19/70 (27%)
cdr-1NP_506986.1 GST_N_Metaxin_like 44..117 CDD:239378 32/73 (44%)
GST_C_Metaxin <199..267 CDD:198302 24/86 (28%)
GstA <204..267 CDD:223698 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D1180930at2759
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.