DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and cdr-6

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_506113.1 Gene:cdr-6 / 179703 WormBaseID:WBGene00010471 Length:277 Species:Caenorhabditis elegans


Alignment Length:284 Identity:98/284 - (34%)
Similarity:138/284 - (48%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AVAAPVATKSEAPPA--QKFNVHKTNFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYE 139
            |:|..:..|...||.  .|..:|||:::||.:|||||.|....|:|||:|:|:|...|:..:.||
 Worm    15 AIAFFIYKKFFTPPTIKPKPAIHKTDYKKDTVYLYQFKRLKNCPNLSPFCMKIEILCRVYNIPYE 79

  Fly   140 NVDHKMRFRSKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENH 204
            .|:..|. ||:.|.|||||||||.||||.:|...|...::   ...|..||...|.|...|.:||
 Worm    80 IVESSMA-RSRNGTLPFIELNGEHIADSDLIEIRLRQHFK---IPSLPTEQEAQSVALSRMADNH 140

  Fly   205 LIWIIFYWRAKYPDNVLKGYKVNLQHALG-LRLP---NSILNFFFKITFGRKWFQGTKKLKAHGI 265
            |    ||...:|..:|...|::    .:| |.||   |::|....|..||.|.:...    ...|
 Worm   141 L----FYVLLRYKSSVDMFYEI----IVGLLGLPSAFNAVLVPLVKAVFGSKVYSRC----VGAI 193

  Fly   266 GVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTE 330
            |.....|::|....||||:.:.:..| |.|||:.|..|...|..|:.::       ||||     
 Worm   194 GDFEPHELDELLHRDLKVIQDSIKGK-FLFGDKITPTDATVFGQLASVY-------YPLR----- 245

  Fly   331 KCPNLIGHVSRMKDKCFPDWDEIC 354
                  .|::.:.:|.||...|.|
 Worm   246 ------SHINDVLEKDFPKILEYC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 36/73 (49%)
GST_C_Metaxin <272..343 CDD:198302 20/70 (29%)
cdr-6NP_506113.1 GST_N_Metaxin_like 46..118 CDD:239378 36/72 (50%)
GST_C_Metaxin <200..267 CDD:198302 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D1180930at2759
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.