DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and C25H3.7

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001254102.1 Gene:C25H3.7 / 173961 WormBaseID:WBGene00016116 Length:275 Species:Caenorhabditis elegans


Alignment Length:269 Identity:82/269 - (30%)
Similarity:134/269 - (49%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KTNFEKDIIYLYQFSR-TPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFR-SKKGQLPFIELN 160
            |||::::::|||||.| ....|:|||||||:||:||...:|:|.|...:..| |.:|.|||||||
 Worm    32 KTNWKENVVYLYQFPRPANRQPNLSPYCLKIETFLRANRIKHEVVGTWLTLRQSPRGLLPFIELN 96

  Fly   161 GEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLE---NHLIWIIFYWRAKYPDNVLK 222
            |::|:||.:|:.:|...::  ||..|....|..:.|...|::   |:.:              |.
 Worm    97 GQQISDSQVIVWKLQKHFD--LDDKLEGSDRGTARAVERMIDLSTNYAL--------------LV 145

  Fly   223 GYKVNLQHAL------GLRLPNSILNFFFKITFGRKWFQGTKKLKAHGI-GVHSAEEIEEFGKDD 280
            ...||..|.|      .|.||:.:.|:.      .|.|..|.:.:.:|: |.....|.:|..:.|
 Worm   146 DKTVNNAHLLLARQVSNLPLPSFLTNYL------AKGFSQTARKRVNGVLGKLDVAEQKELLRRD 204

  Fly   281 LKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLR----DYMTEKCPNLIGHVSR 341
            ::.:.::|..|.|.|||..|::|...|..:..:.||      |.|    |.:.:..|.:..:..|
 Worm   205 IRAIDDILGDKKFLFGDRITSVDCSVFGQIGAVFYL------PYRQQISDLLEDDFPRVRAYCDR 263

  Fly   342 MKDKCFPDW 350
            ::...:|:|
 Worm   264 IRQHYYPEW 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 37/75 (49%)
GST_C_Metaxin <272..343 CDD:198302 19/74 (26%)
C25H3.7NP_001254102.1 GST_N_Metaxin_like 39..115 CDD:239378 37/75 (49%)
GstA 54..267 CDD:223698 70/240 (29%)
GST_C_Metaxin 194..265 CDD:198302 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D1180930at2759
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.