DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and F53G12.9

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001293265.1 Gene:F53G12.9 / 171603 WormBaseID:WBGene00018774 Length:252 Species:Caenorhabditis elegans


Alignment Length:254 Identity:74/254 - (29%)
Similarity:124/254 - (48%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 RTPLLPSLSPYCLKVETWLRLVGLKYENVDHKM-RFRSKKGQLPFIELNGEEIADSAIIIKELSS 176
            ||..:|..:|.||.:||:||...:.||.....: ....::...|.|:::|....:....:..|.:
 Worm    13 RTVTVPYYAPSCLFLETFLRSKLIPYETTQCSLYNVLPREHLYPLIDVDGYFFKNLMEGLDYLLA 77

  Fly   177 KYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSIL 241
            ||.|.||||||.::|..:.|..|:|: .|.|::.|.|.              |....||....|:
 Worm    78 KYGKSLDSGLTPKERAQALALSALLD-ELTWMLAYSRG--------------QDFTWLRDDRKII 127

  Fly   242 NFF--FKITFGRKWF------QGTKKLKAHGIGVHSA-EEIEEFGKDDLKVLSEMLDCKPFFFG- 296
            ..|  .::.|.|.|.      :..::::.:||...|| :|:....:..|:.|:.:|....:||. 
 Worm   128 EDFGLVQLYFWRNWIVPQMQKRTRRRVRGYGISGKSARKEVACRTEAMLEALASLLASNKYFFDV 192

  Fly   297 DEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEICT 355
            :||:.||..|||||:|..|........::.:|.::.|||:..|:|||::.:.||   ||
 Worm   193 NEPSWLDCKAFAVLAQFKYTPLQNEARVKQFMKDRTPNLMTFVTRMKEEFWSDW---CT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 17/66 (26%)
GST_C_Metaxin <272..343 CDD:198302 23/71 (32%)
F53G12.9NP_001293265.1 GST_N_Metaxin 8..78 CDD:239352 16/64 (25%)
GST_C_6 173..238 CDD:379935 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55848
OrthoDB 1 1.010 - - D1180930at2759
OrthoFinder 1 1.000 - - FOG0001184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.