DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fax and MTX2

DIOPT Version :9

Sequence 1:NP_524106.3 Gene:fax / 39826 FlyBaseID:FBgn0014163 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_006545.1 Gene:MTX2 / 10651 HGNCID:7506 Length:263 Species:Homo sapiens


Alignment Length:282 Identity:66/282 - (23%)
Similarity:120/282 - (42%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EAVAAPVATKSEAPPAQKFNVHKTNFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYEN 140
            ||..:.:|.....|            |...:| .|.....:|.|.:...|.|:.:|::..|..:.
Human     6 EAFVSQIAAAEPWP------------ENATLY-QQLKGEQILLSDNAASLAVQAFLQMCNLPIKV 57

  Fly   141 VDH-KMRFRSKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENH 204
            |.. ...:.|..|::|||.:..:.:::...|::.:.:|... |..||...|:....|.:.::.|.
Human    58 VCRANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHS-LSDGLEEVQKAEMKAYMELVNNM 121

  Fly   205 LIWIIFYWRAKYPDNVLKGYKVNLQHA-LGLRLP---NSILNFFFKITFGRKWFQGTKKLKAHGI 265
            |:....|  .::.|....|   .:.|| .|...|   |.||.:       :|.::..:|:||.|.
Human   122 LLTAELY--LQWCDEATVG---EITHARYGSPYPWPLNHILAY-------QKQWEVKRKMKAIGW 174

  Fly   266 GVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTE 330
            |..:.:::.|......:.||:.|..:|:||..:||.||.:.|..|..:  |:..:.   .|.::|
Human   175 GKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTI--LTTQLT---NDELSE 234

  Fly   331 KC---PNLIGHVSRMKDKCFPD 349
            |.   .||:....|::...|.|
Human   235 KVKNYSNLLAFCRRIEQHYFED 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
faxNP_524106.3 GST_N_Metaxin_like 105..179 CDD:239378 16/74 (22%)
GST_C_Metaxin <272..343 CDD:198302 20/73 (27%)
MTX2NP_006545.1 GST_N_Metaxin2 22..95 CDD:239377 15/73 (21%)
GST_C_Metaxin2 125..250 CDD:198320 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.