DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAF2 and Deaf1

DIOPT Version :9

Sequence 1:NP_001261943.1 Gene:RAF2 / 39821 FlyBaseID:FBgn0036624 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001262069.1 Gene:Deaf1 / 40164 FlyBaseID:FBgn0013799 Length:576 Species:Drosophila melanogaster


Alignment Length:231 Identity:50/231 - (21%)
Similarity:88/231 - (38%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   943 PAKRPKLIHSQDSNQDMASSSTHLSA--NLSETLRKIRAWKNYSHFSNVSMEDNNS-----DN-E 999
            |.::....||.::|.:..:::|..|.  |..:....:.|       :..|:.|.|:     :| .
  Fly   337 PKRKRNTHHSNNNNSNTNNNNTSGSGANNCVDVTAAVAA-------ATASVVDENNMFLSEENIT 394

  Fly  1000 SQIEP-------LFNSSPMASRRQLANRQSYQ-EQHSANINDHENVQKRHKSHKRKSHKH----- 1051
            |:.||       |..|:.:..:.|:.|  :|: |....||||..::.....|...|:.:|     
  Fly   395 SKDEPWAALNDSLDTSTELVDQSQMGN--TYERETFVVNINDGSSIAVLDTSQSMKNIEHVYCTM 457

  Fly  1052 ---------------KSHKHR------------SSHKSQAES-------SATINGN---TGRQCH 1079
                           :|.:.|            |:.:.|..:       |.:::||   :.::|.
  Fly   458 VKATNDFKRMLNDMKQSFERRIEVLQKERDAAVSAMRVQVHADIDDPNISGSLHGNEIISAKKCA 522

  Fly  1080 ECKLYGATFMCSNCQNQWYCSRECQLSDWDTHHRTC 1115
            .|. ..|...||.|:...|||..||..||:.|...|
  Fly   523 NCN-REALAECSLCRKTPYCSEFCQRKDWNAHQVEC 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAF2NP_001261943.1 zf-MYND 1078..1115 CDD:280009 14/36 (39%)
Deaf1NP_001262069.1 SAND 219..291 CDD:128554
zf-MYND 521..557 CDD:280009 14/36 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10237
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.