powered by:
Protein Alignment RAF2 and Zmynd10
DIOPT Version :9
Sequence 1: | NP_001261943.1 |
Gene: | RAF2 / 39821 |
FlyBaseID: | FBgn0036624 |
Length: | 1117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648625.1 |
Gene: | Zmynd10 / 39481 |
FlyBaseID: | FBgn0266709 |
Length: | 451 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 19/51 - (37%) |
Similarity: | 27/51 - (52%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1065 ESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCSRECQLSDWDTHHRTC 1115
::.|..:|:|...|..|:. .|...|:.|:...||||:|||.||..|...|
Fly 399 DAGAGGDGDTDHTCATCQA-KAKKKCACCKKVHYCSRDCQLKDWPQHKLVC 448
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005808 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.