DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAF2 and Zmynd10

DIOPT Version :9

Sequence 1:NP_001261943.1 Gene:RAF2 / 39821 FlyBaseID:FBgn0036624 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_648625.1 Gene:Zmynd10 / 39481 FlyBaseID:FBgn0266709 Length:451 Species:Drosophila melanogaster


Alignment Length:51 Identity:19/51 - (37%)
Similarity:27/51 - (52%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1065 ESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCSRECQLSDWDTHHRTC 1115
            ::.|..:|:|...|..|:. .|...|:.|:...||||:|||.||..|...|
  Fly   399 DAGAGGDGDTDHTCATCQA-KAKKKCACCKKVHYCSRDCQLKDWPQHKLVC 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAF2NP_001261943.1 zf-MYND 1078..1115 CDD:280009 15/36 (42%)
Zmynd10NP_648625.1 zf-MYND <429..448 CDD:280009 10/18 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005808
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.