DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAF2 and AgaP_AGAP011078

DIOPT Version :9

Sequence 1:NP_001261943.1 Gene:RAF2 / 39821 FlyBaseID:FBgn0036624 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_309572.4 Gene:AgaP_AGAP011078 / 1270850 VectorBaseID:AGAP011078 Length:428 Species:Anopheles gambiae


Alignment Length:375 Identity:78/375 - (20%)
Similarity:132/375 - (35%) Gaps:96/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 DKINSVPPDEDSLKKERERIVADLAALDKLMAQKEDEYNRLLYLSCIKKELHE-RMERKERLIRI 824
            |:.:..||||...:...|.:|.....:|..:..|.     |..:|.:.:.|.: .:....||:|:
Mosquito   126 DREDDPPPDELLNESTAEEVVRMGRTMDFRIGVKS-----LGIVSYLVEGLDQLPLSAATRLVRV 185

  Fly   825 KDLLPILINKCGTKELSEVKAMLEEEIDSPMASKHSLSAIEKLLNYAELNQNIIQLLRGSLGLNK 889
            .| .|.||     .|:...|..|...                       .:.:.:..|....:..
Mosquito   186 HD-FPCLI-----AEVLHAKPWLRRN-----------------------REGVFEKYRNGSWIPA 221

  Fly   890 RAPSVSPANFEDDQMLFRRDSLPVSHLSMRD------QHYESRNAV---NDHLLDSNPDRDPPAK 945
            ...::......:.|..|....|..|...|||      :|.|....:   |:.|||..|...|  .
Mosquito   222 HGDAILKVTETEAQTWFCLYRLLFSGDLMRDYEINGYRHREIGKCIGLMNEQLLDQLPALIP--L 284

  Fly   946 RPKLIHSQDSNQDMASSSTHLSANLSETLRKIRAWKNYSHFSNVSMEDNNSDNESQIEPLFNSSP 1010
            :..|...|.:|:....:....::.|.|.|.::|                  |...|         
Mosquito   285 KQHLCTLQLTNEAGGGTGGSTASLLLEELPEVR------------------DRLMQ--------- 322

  Fly  1011 MASRR----QLANRQSYQEQHSANINDHENVQ--KR----HKSHKRKSHKHKSHKHRSSHKSQAE 1065
             |:||    |:..:   |.:...::.:|:.|:  ||    :.:...:.:..:..|.|...::.| 
Mosquito   323 -AARRTGWDQIVEK---QRKIFIDLEEHDVVEMAKRIGAAYNTDLLERYTEQEEKRRKQGENYA- 382

  Fly  1066 SSATINGNTGRQCHECKLYGATFMCSNCQNQWYCSRECQLSDWDTHHRTC 1115
            |:..:.||.|.        .|...||||.:.:||||:|||.:|..|...|
Mosquito   383 SAVKVCGNCGA--------SAAKKCSNCMHVYYCSRDCQLQNWTDHKELC 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAF2NP_001261943.1 zf-MYND 1078..1115 CDD:280009 14/36 (39%)
AgaP_AGAP011078XP_309572.4 zf-MYND 388..424 CDD:280009 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005808
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.