DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAF2 and Zmynd10

DIOPT Version :9

Sequence 1:NP_001261943.1 Gene:RAF2 / 39821 FlyBaseID:FBgn0036624 Length:1117 Species:Drosophila melanogaster
Sequence 2:XP_006511693.1 Gene:Zmynd10 / 114602 MGIID:2387863 Length:478 Species:Mus musculus


Alignment Length:330 Identity:65/330 - (19%)
Similarity:112/330 - (33%) Gaps:121/330 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 KELSEVKAMLEEEID----------SPMASKHSLSAIEKLLNYAELNQNIIQLLRGSLGLNK--- 889
            :||.:...|:|.||.          :......|||.:.::|....|...:::||..|....:   
Mouse   208 QELQKQAEMMEFEISLKALSVLRYITDCVDSLSLSTLNRMLRTHNLPCLLVELLEHSPWSRRVGG 272

  Fly   890 --------RAPSVSPANFEDDQMLFRRDS---LPVSHLSM--------------RDQHYESRNAV 929
                    |..:|:|:   :.|.|.:.|.   :.:.:|.:              :.|..:.:..:
Mouse   273 KLQHFESGRWQTVAPS---EQQKLNKLDGQVWIALYNLLLSPEARARYCLTSFAKGQLLKLQAFL 334

  Fly   930 NDHLLDSNPDRDPPAKRPKLIHSQDSNQDMASSSTHLSANLSET--------LRKI-RAWKNYSH 985
            .|.|||..|:.                .|:.....|||  |:||        |.:| ..|..   
Mouse   335 TDTLLDQLPNL----------------ADLKGFLAHLS--LAETQPPKKDLVLEQIPEIWDR--- 378

  Fly   986 FSNVSMEDNNSDN-----ESQIEPLFNSSPMASRRQLANRQSYQEQHSANINDHENVQKRHKSHK 1045
                 :|..|...     :.|::.:|:.|....|:|   .|.:.|.:..::.:....::      
Mouse   379 -----LERENKGKWQAIAKHQLQHVFSLSEKDLRQQ---AQRWAETYRLDVLEAVAPER------ 429

  Fly  1046 RKSHKHKSHKHRSSHKSQAESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCSRECQLSDWDT 1110
                                          .:|..|.. .|:..||.|||.|||.||||:..|:.
Mouse   430 ------------------------------PRCGYCNA-EASKRCSRCQNVWYCCRECQVKHWEK 463

  Fly  1111 HHRTC 1115
            |.:||
Mouse   464 HGKTC 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAF2NP_001261943.1 zf-MYND 1078..1115 CDD:280009 17/36 (47%)
Zmynd10XP_006511693.1 zf-MYND 432..468 CDD:366792 17/36 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11800
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6296
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005808
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.