DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and GPT2

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_012993.3 Gene:GPT2 / 853941 SGDID:S000001775 Length:743 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:53/248 - (21%)
Similarity:88/248 - (35%) Gaps:97/248 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AKKAIRYVP----------------IIGWGWWLAEFVFLNRNFDQDKTIITEQLKV--VFSYPD- 180
            |.|.|.:||                |..|.:.::.|:| |..|    ||...::||  .::.|: 
Yeast    10 AAKPIPHVPQASRRYKNSYNGFVYNIHTWLYDVSVFLF-NILF----TIFFREIKVRGAYNVPEV 69

  Fly   181 --PTWLLLNAEGTRF-TPA------------------------KHEASVKFAQERGMTVLKHHL- 217
              ||.|:......:| .||                        ..|:|.|   :|.::...|.: 
Yeast    70 GVPTILVCAPHANQFIDPALVMSQTRLLKTSAGKSRSRMPCFVTAESSFK---KRFISFFGHAMG 131

  Fly   218 ---IPRTKGFTASLAPIRGLCPVIYDINL-AYRPTDKTPATMLSLLHGKSVEPH----------- 267
               :||.:.   :|.|:        |.|| .|.|..|...   .::.|:|..|.           
Yeast   132 GIPVPRIQD---NLKPV--------DENLEIYAPDLKNHP---EIIKGRSKNPQTTPVNFTKRFS 182

  Fly   268 ---LL-----MRRIPLEQVPEDEKEAAAWLQNLF-VEKDKIIDSFLETGSFFK 311
               ||     :....::::|:||   ...|.:.| ..|.|::: .|..|:.||
Yeast   183 AKSLLGLPDYLSNAQIKEIPDDE---TIILSSPFRTSKSKVVE-LLTNGTNFK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 53/248 (21%)
LPLAT_LCLAT1-like 75..271 CDD:153252 42/205 (20%)
Acyltransf_C 258..336 CDD:292694 16/74 (22%)
GPT2NP_012993.3 LPLAT 45..348 CDD:418432 46/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.