DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and LPCAT1

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_011512434.1 Gene:LPCAT1 / 79888 HGNCID:25718 Length:571 Species:Homo sapiens


Alignment Length:394 Identity:75/394 - (19%)
Similarity:120/394 - (30%) Gaps:168/394 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEH--------VLLIMNHKYEI 113
            |:||::.:...::...:     |:||.          |.:.|.|..        :|.:..|....
Human   127 LWRKVVDFLLKAIMRTM-----WFAGG----------FHRVAVKGRQALPTEAAILTLAPHSSYF 176

  Fly   114 DWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEF---VFLNRNFDQD---KTIITEQL 172
            |.:...|....:        ..|...|.:||  || .|.::   ||::|: |||   ||:  |::
Human   177 DAIPVTMTMSSI--------VMKAESRDIPI--WG-TLIQYIRPVFVSRS-DQDSRRKTV--EEI 227

  Fly   173 K------------------------------------------VVFSYPDP-------------- 181
            |                                          ||..||:.              
Human   228 KRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGAL 292

  Fly   182 --TWLLL----------------NAEGTRFTPAKHEASVK--FAQERGMTVLKHHLIPRTKGFTA 226
              .||.|                .:|..:..||.:.::|:  .|:..|::|..:           
Human   293 EILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDY----------- 346

  Fly   227 SLAPIRGLCPVIYDINLAYR------PTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVPE----- 280
                      ...|..||..      |.|........|:.|..::|..|.:  .|::..|     
Human   347 ----------TFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEK--DLDRYSERARMK 399

  Fly   281 -DEK----EAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFS 340
             .||    |.||.|:  ....|.:.|.|    |.|..||..|    |:.|.....::.||....:
Human   400 GGEKIGIAEFAASLE--VPVSDLLEDMF----SLFDESGSGE----VDLRECVVALSVVCRPART 454

  Fly   341 LSCI 344
            |..|
Human   455 LDTI 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 75/394 (19%)
LPLAT_LCLAT1-like 75..271 CDD:153252 50/291 (17%)
Acyltransf_C 258..336 CDD:292694 23/87 (26%)
LPCAT1XP_011512434.1 PlsC 95..>279 CDD:223282 34/180 (19%)
LPLAT_LPCAT1-like 140..351 CDD:153253 41/260 (16%)
EF-hand_7 458..516 CDD:290234 1/1 (100%)
EF-hand_8 469..520 CDD:290545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.