DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Tmem68

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_082373.1 Gene:Tmem68 / 72098 MGIID:1919348 Length:329 Species:Mus musculus


Alignment Length:275 Identity:52/275 - (18%)
Similarity:96/275 - (34%) Gaps:93/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSL--YSQLIFVSDWYAGSKMTVYMDKE 92
            :.|:...:.|:|...:..:||:  ..|..|.:..:..:.:  :|.|:.|.       ..::..:|
Mouse   125 IIFYHGAIPIDFYYFMAKIFIQ--KGRTCRVVADHFVFKIPGFSLLLDVF-------CALHGPRE 180

  Fly    93 DFEKHAGKEHVL----------LIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAI-RYVPIIG 146
            ...:.....|:|          |:.:..|.|.|             ||.|.:|:.|| ..|||| 
Mouse   181 KCVEILRSGHLLAISPGGVREALLSDETYNIIW-------------GNRKGFAQVAIDAKVPII- 231

  Fly   147 WGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMT 211
                               .:.|:.::..|.         :..|||.        .|:..|:   
Mouse   232 -------------------PMFTQNIREGFR---------SLGGTRL--------FKWLYEK--- 257

  Fly   212 VLKHHLIPRTKGFTASLAPIRGLCPVIYDINL-AYRPTDKTPATMLSLLHGKSVEPHLLMRRIP- 274
             .::...|...||...|....| .|:.||..: |....:||...:.:|     ::.|   :||| 
Mouse   258 -FRYPFAPMYGGFPVKLRTFLG-DPIPYDPKVTAEELAEKTKNAVQAL-----IDKH---QRIPG 312

  Fly   275 ------LEQVPEDEK 283
                  |::..:::|
Mouse   313 NIRSALLDRFHKEQK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 52/275 (19%)
LPLAT_LCLAT1-like 75..271 CDD:153252 38/207 (18%)
Acyltransf_C 258..336 CDD:292694 7/33 (21%)
Tmem68NP_082373.1 PlsC 58..303 CDD:223282 45/241 (19%)
LPLAT_MGAT-like 103..309 CDD:153249 47/255 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.