DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat2

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_080488.1 Gene:Agpat2 / 67512 MGIID:1914762 Length:278 Species:Mus musculus


Alignment Length:222 Identity:48/222 - (21%)
Similarity:75/222 - (33%) Gaps:74/222 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RLFRKLMYYACYSLYSQL-----------------------IFVSDWYAGSKMTVYMDKEDFEKH 97
            :|.|...:||...||..|                       :.:..|:..|...||..:  ||..
Mouse    19 QLSRTARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLR--FEVS 81

  Fly    98 AGKE-----HVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFL 157
            ..|:     ..::|.||:..:|.:....|..|     .|...||:.:.:...:|...:|....|:
Mouse    82 GQKKLEVDGPCVIISNHQSILDMMGLMEILPK-----RCVQIAKRELMFTGPVGLIMYLGGVYFI 141

  Fly   158 NRN---------FDQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMTVL 213
            ||.         .|....::.|.|| |:.||         ||||             .:.|    
Mouse   142 NRQQARTAMSVMADLGDLMVKENLK-VWIYP---------EGTR-------------NDNG---- 179

  Fly   214 KHHLIPRTKG-FTASLAPIRGLCPVIY 239
              .|:|..|| |..::.....:.||:|
Mouse   180 --DLLPFKKGAFYLAIQAQVPIIPVVY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 48/222 (22%)
LPLAT_LCLAT1-like 75..271 CDD:153252 41/180 (23%)
Acyltransf_C 258..336 CDD:292694
Agpat2NP_080488.1 PlsC 30..259 CDD:223282 44/211 (21%)
LPLAT_AGPAT-like 67..240 CDD:153251 40/174 (23%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 98..103 1/4 (25%)
EGTR motif. /evidence=ECO:0000250|UniProtKB:O15120 172..175 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.