Sequence 1: | NP_001246793.1 | Gene: | Agpat3 / 39820 | FlyBaseID: | FBgn0036623 | Length: | 397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001037806.2 | Gene: | lpcat1 / 555969 | ZFINID: | ZDB-GENE-060503-915 | Length: | 517 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 49/209 - (23%) |
---|---|---|---|
Similarity: | 87/209 - (41%) | Gaps: | 50/209 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KNSFV--IKMGSLEKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVF------------IKPIDK 55
Fly 56 RLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWM 120
Fly 121 ICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEF---VFLNRNFDQD---KTIITEQLKVVFSYP 179
Fly 180 DPTW--LLLNAEGT 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Agpat3 | NP_001246793.1 | PLN02380 | 23..387 | CDD:178006 | 42/189 (22%) |
LPLAT_LCLAT1-like | 75..271 | CDD:153252 | 30/125 (24%) | ||
Acyltransf_C | 258..336 | CDD:292694 | |||
lpcat1 | NP_001037806.2 | PlsC | 52..>236 | CDD:223282 | 40/177 (23%) |
LPLAT_LPCAT1-like | 97..308 | CDD:153253 | 30/125 (24%) | ||
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 | 129..134 | 1/4 (25%) | |||
EF-hand_7 | 413..472 | CDD:290234 | |||
EF-hand_8 | 424..475 | CDD:290545 | |||
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 | 514..517 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |