DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and lpcat1

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001037806.2 Gene:lpcat1 / 555969 ZFINID:ZDB-GENE-060503-915 Length:517 Species:Danio rerio


Alignment Length:209 Identity:49/209 - (23%)
Similarity:87/209 - (41%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KNSFV--IKMGSLEKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVF------------IKPIDK 55
            :|.||  ::..:|:|||    |.:.....|....|...|:.||...|            ::|:. 
Zfish    24 RNPFVHELRFTTLQKLK----IAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGRSENAVEPLS- 83

  Fly    56 RLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWM 120
             .:|.|:     .|..:.|..:.|::|....|.:  :.......:..:|.:..|....|.:...|
Zfish    84 -WWRWLV-----DLALKAIMRAMWFSGGFHWVRV--KGRPALPSEAPILTMAPHSSYFDAIPVTM 140

  Fly   121 ICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEF---VFLNRNFDQD---KTIITEQLKVVFSYP 179
            ....:.:    ||.:|.    :|:  || .|.:|   ||::|: |||   ||:  |::|...| .
Zfish   141 TMASIVM----KAESKD----IPV--WG-TLIKFIRPVFVSRS-DQDSRRKTV--EEIKRRAS-S 190

  Fly   180 DPTW--LLLNAEGT 191
            :..|  :::..|||
Zfish   191 NGEWPQIMIFPEGT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 42/189 (22%)
LPLAT_LCLAT1-like 75..271 CDD:153252 30/125 (24%)
Acyltransf_C 258..336 CDD:292694
lpcat1NP_001037806.2 PlsC 52..>236 CDD:223282 40/177 (23%)
LPLAT_LPCAT1-like 97..308 CDD:153253 30/125 (24%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 129..134 1/4 (25%)
EF-hand_7 413..472 CDD:290234
EF-hand_8 424..475 CDD:290545
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.