DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and AGPAT5

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_060831.2 Gene:AGPAT5 / 55326 HGNCID:20886 Length:364 Species:Homo sapiens


Alignment Length:271 Identity:73/271 - (26%)
Similarity:137/271 - (50%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FIKPIDKRLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEI 113
            |.:.:|.||      |..|.  |.::|..:.|.|.::.:|   .|..|:  ||:::.:.||:..:
Human    46 FYQALDDRL------YCVYQ--SMVLFFFENYTGVQILLY---GDLPKN--KENIIYLANHQSTV 97

  Fly   114 DWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEF--VFLNRNFDQDKTIITEQLKVVF 176
            ||:...::..:...||:.:...|:.::::|:  :|.:.|:.  :::.|:...::..:..:|:   
Human    98 DWIVADILAIRQNALGHVRYVLKEGLKWLPL--YGCYFAQHGGIYVKRSAKFNEKEMRNKLQ--- 157

  Fly   177 SYPD---PTWLLLNAEGTRFTPAKHE---ASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLC 235
            ||.|   |.:|::..||||:.|.:.:   ||..||.:||:.||||.|.||.|....:...::...
Human   158 SYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDCMKNYL 222

  Fly   236 PVIYDINLAYRPTD-----KTPATMLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVE 295
            ..|||:.:.|...|     :...||...|..:..:.|:.:.||..:.|||:::....||...|..
Human   223 DAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEI 287

  Fly   296 KDKIIDSFLET 306
            |||::..|.|:
Human   288 KDKMLIEFYES 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 73/271 (27%)
LPLAT_LCLAT1-like 75..271 CDD:153252 53/208 (25%)
Acyltransf_C 258..336 CDD:292694 15/49 (31%)
AGPAT5NP_060831.2 PlsC 34..281 CDD:223282 65/252 (26%)
LPLAT_LCLAT1-like 63..263 CDD:153252 53/209 (25%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 93..98 1/4 (25%)
Acyltransf_C 258..318 CDD:292694 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51956
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3473
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.