Sequence 1: | NP_001246793.1 | Gene: | Agpat3 / 39820 | FlyBaseID: | FBgn0036623 | Length: | 397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002685.1 | Gene: | gpat3 / 436958 | ZFINID: | ZDB-GENE-040718-436 | Length: | 449 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 38/199 - (19%) |
---|---|---|---|
Similarity: | 67/199 - (33%) | Gaps: | 74/199 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 LKQLRLIHLCIALTFFTSGLCI----------NFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQ 72
Fly 73 LIFVSDWYAGSKMTV-YMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYA- 135
Fly 136 -------------KKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLN 187
Fly 188 AEGT 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Agpat3 | NP_001246793.1 | PLN02380 | 23..387 | CDD:178006 | 35/194 (18%) |
LPLAT_LCLAT1-like | 75..271 | CDD:153252 | 27/132 (20%) | ||
Acyltransf_C | 258..336 | CDD:292694 | |||
gpat3 | NP_001002685.1 | LPLAT_LPCAT1-like | 208..417 | CDD:153253 | 28/140 (20%) |
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 | 238..243 | 1/4 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |