DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat1

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006256034.1 Gene:Agpat1 / 406165 RGDID:1303287 Length:322 Species:Rattus norvegicus


Alignment Length:306 Identity:60/306 - (19%)
Similarity:107/306 - (34%) Gaps:113/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LRLIHLCIALTFFTSGLCINFIQ--------LLMHVFIKPI---------DKRLFRKLMYYACYS 68
            |.|:.|.::..:|.|.....|.:        |.:.:...|:         :.::.|.|:.:..| 
  Rat    50 LLLLLLLLSTLWFCSSSAKYFFKMAFYNGWILFLAILAIPVCAVRGRNVENMKILRLLLLHVKY- 113

  Fly    69 LYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEH------VLLIMNHKYEIDWLNGWMICEKLGV 127
            ||           |.::.|          .|.:|      .:::.||:..:|.|.      .:.|
  Rat   114 LY-----------GIRVEV----------RGAQHFPPTQPYVVVSNHQSSLDLLG------MMEV 151

  Fly   128 L-GNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQD---------KTIITEQLKVVFSYPDPT 182
            | ..|...||:.:.:....|...|||..:|::|....|         :|::|:.::|        
  Rat   152 LPDRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRV-------- 208

  Fly   183 WLLLNAEGTRFTPAKHEASVKFAQERG----------------MTVLKHHLIPRTKGFTASLAPI 231
            |:.  .||||    .|..|: ...:||                |:..:.....:.:.||:....:
  Rat   209 WVF--PEGTR----NHNGSM-LPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGRCQV 266

  Fly   232 RGLCPVIYDINLAYRPT-----DKTPA-------TMLSLLHGKSVE 265
            |.|.||         ||     |..||       :||::....|.:
  Rat   267 RVLPPV---------PTEGLTPDDVPALADRVRHSMLTIFREISTD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 59/304 (19%)
LPLAT_LCLAT1-like 75..271 CDD:153252 47/235 (20%)
Acyltransf_C 258..336 CDD:292694 1/8 (13%)
Agpat1XP_006256034.1 LPLAT_AGPAT-like 104..290 CDD:153251 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.