DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and tmem68

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_956786.1 Gene:tmem68 / 393464 ZFINID:ZDB-GENE-040426-1267 Length:331 Species:Danio rerio


Alignment Length:273 Identity:51/273 - (18%)
Similarity:83/273 - (30%) Gaps:117/273 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PIDKRLFRKLMYY-----------ACYSLYSQLIFVSDWYAGSKM------TVYMDKEDFEKHAG 99
            |:|       .||           .|:|:....:|.   ..|.|:      .::..:|:..:...
Zfish   135 PVD-------YYYFLATVIIQKGRTCHSVADHFLFK---VPGFKLLLEVFSVIHGPQEECVRALR 189

  Fly   100 KEHVL----------LIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAI-RYVPIIGWGWWLAE 153
            ..|:|          |..:..|.:.|             |..|.:|:.|| ..||:|        
Zfish   190 NGHLLGISPGGVREALFSDETYPLLW-------------GKRKGFAQVAIDSKVPVI-------- 233

  Fly   154 FVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGT-RFTPAKHEASVKFAQERGMTVLKHHL 217
                        .:.|:.|:..|          .:.|| ||        .::..||         
Zfish   234 ------------PMFTQNLREGF----------RSLGTLRF--------FRWVYER--------- 259

  Fly   218 IPRTKGFTASLAPIRGLCPV----------IYDINL-AYRPTDKTPATMLSLLHGKSVEPHLLMR 271
                  |...:|||.|..||          .||..| |....:|....:.:|:......|..::|
Zfish   260 ------FRLPVAPIYGGFPVKFRTFLGDPIPYDPKLNAAELAEKVQQAVQALIDKHQKIPGNILR 318

  Fly   272 RIPLEQVPEDEKE 284
            .: ||:...:.||
Zfish   319 AL-LERFQREHKE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 51/273 (19%)
LPLAT_LCLAT1-like 75..271 CDD:153252 40/224 (18%)
Acyltransf_C 258..336 CDD:292694 7/27 (26%)
tmem68NP_956786.1 PlsC 51..310 CDD:223282 45/250 (18%)
LPLAT_MGAT-like 104..311 CDD:153249 45/251 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.