DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat2

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster


Alignment Length:312 Identity:66/312 - (21%)
Similarity:116/312 - (37%) Gaps:111/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLRLIHLCIALTFFTSG----LCINFIQLLMHVFIKPIDKRLFRKLMYYA-CYSLYSQLIFVSDW 79
            |:|:..:     ||.:|    ||:.|      :.::|.|   :|..::.: |:....:|:.::  
  Fly    27 QMRMFFI-----FFGAGLIVFLCVPF------MILRPRD---YRNALFPSWCFRQLCRLVGIT-- 75

  Fly    80 YAGSKMTVYMDKEDFEKHAGKEH-VLLIMNHKYEID-------WLNGWMICEKLGVLGNCKAYAK 136
                     |:....| :..|:| .::||||:..:|       |          .|:|.....:|
  Fly    76 ---------MEVRGLE-NVRKDHGAVVIMNHQSAVDLCVLAYLW----------PVIGRATVVSK 120

  Fly   137 KAIRYVPIIGWGWWLAEFVFLNRNFDQD---------KTIITEQLKVVFSYPDPTWLLLNAEGTR 192
            |.:.|:|..|.|.||...::::|:...|         |.|.....|          |||..||||
  Fly   121 KEVLYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNCK----------LLLFPEGTR 175

  Fly   193 FTPAKHEASVKFAQERGMTVLKHHLIPRTKG-FTASL---APIRGLCPVIY-------DINLAYR 246
            .:                   |..|:|..|| |..:|   :|::   ||:.       |....:|
  Fly   176 NS-------------------KDSLLPFKKGSFHIALQGKSPVQ---PVVISKYSFMDDEKKTFR 218

  Fly   247 PTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDK 298
            |..       :|:|   :.|.:...:...|.|.....|..:.:|..:.:..|
  Fly   219 PGH-------ALIH---ILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 64/309 (21%)
LPLAT_LCLAT1-like 75..271 CDD:153252 48/223 (22%)
Acyltransf_C 258..336 CDD:292694 8/41 (20%)
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 52/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.