DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and CG15450

DIOPT Version :10

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster


Alignment Length:41 Identity:11/41 - (26%)
Similarity:17/41 - (41%) Gaps:15/41 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 WLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFV 155
            ||.||::  :.|:|             :|....|.||..|:
  Fly   137 WLLGWVV--RYGLL-------------LPFRTIGCWLCLFM 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 11/41 (27%)
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.