DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and aup1

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_005173140.1 Gene:aup1 / 324654 ZFINID:ZDB-GENE-030131-3375 Length:429 Species:Danio rerio


Alignment Length:191 Identity:39/191 - (20%)
Similarity:72/191 - (37%) Gaps:50/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KMGSLEKLKQLRLIHLCIALTFFTSGLCINFIQLL--MHVFI------KPIDKRLFRKLMYYACY 67
            :|...::|...|.| |.:.|.:...|.|:..:::.  :|||:      ..|.:|...::|   | 
Zfish     8 QMFDFQRLPNDRFI-LLLLLLYAPVGFCLMLLRIFIGVHVFLVSCALPDSIVRRFIVRIM---C- 67

  Fly    68 SLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCK 132
                           |.:.::: :::..:...|...|.:.||....|.       ..:.:|.:|.
Zfish    68 ---------------SVLGLHV-QQNSPRLRDKTTRLYVCNHVTHFDH-------NIINLLTSCN 109

  Fly   133 AYAKKAIRYVPI----IGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAE 189
                     .|:    :|:..|...|:.|.:... .:|.:||.|....|.||...|||..|
Zfish   110 ---------TPLLEGPVGFLCWARGFMELGQGVG-SRTELTETLHRYCSSPDTLPLLLFPE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 36/179 (20%)
LPLAT_LCLAT1-like 75..271 CDD:153252 24/119 (20%)
Acyltransf_C 258..336 CDD:292694
aup1XP_005173140.1 LPLAT 63..263 CDD:302626 26/135 (19%)
CUE_AUP1 310..354 CDD:270603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.