DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat1

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster


Alignment Length:218 Identity:51/218 - (23%)
Similarity:82/218 - (37%) Gaps:72/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIKMGSLEKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYS-- 71
            :|.|.|..:|..|.|:            |.:.|:....|:|     :..|:.||||...|..|  
  Fly     1 MITMTSFIELLGLFLL------------LMLPFLYETNHIF-----RYYFKFLMYYGIVSFNSII 48

  Fly    72 -------------QLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHV------LLIMNHKYEIDWL- 116
                         .|::.|.|.......:.:..|    ..||||:      :::.||:..:|.| 
  Fly    49 LIPAFLTRPCDVRNLLWASTWCHRVSTLIGLRWE----LRGKEHLAKDQACIIVANHQSSLDVLG 109

  Fly   117 --NGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNR----------NFDQDKTIIT 169
              |.|.:..|      |...||:.:.|....|...|||..:|::|          | |.::.|..
  Fly   110 MFNIWHVMNK------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLN-DVNRRIKK 167

  Fly   170 EQLKVVFSYPDPTWLLLNAEGTR 192
            :::|:        |:.  .||||
  Fly   168 QRIKL--------WVF--PEGTR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 46/204 (23%)
LPLAT_LCLAT1-like 75..271 CDD:153252 33/137 (24%)
Acyltransf_C 258..336 CDD:292694
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 31/132 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.