DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and LOC317456

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001041359.1 Gene:LOC317456 / 317456 RGDID:1549733 Length:268 Species:Rattus norvegicus


Alignment Length:245 Identity:57/245 - (23%)
Similarity:92/245 - (37%) Gaps:53/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 WLAEFVFLNRNF-------------------DQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTP 195
            ||.:.:|...||                   ||...::.:.|:..:...|..|::|..| ..|..
  Rat    24 WLMDHIFKYTNFGIVSLIHGDFFIRQGRAYRDQQLLVLKKHLEHNYRSRDRKWIVLFPE-EGFLR 87

  Fly   196 AKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAPI--------------RGL-CPV-----IYD 240
            .:.|.|..||::..:..|.|..:||.......|..:              ||| |..     |.|
  Rat    88 KRRETSQAFAKKNNLPFLTHVTLPRFGATNIILKALVARQENGSPAGGDARGLECKSRGLQWIID 152

  Fly   241 INLAYRPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDKIIDSFLE 305
            ..:||...:........|.:.|....|:..|..|:..||.:.::...||...|:||:.::..|.:
  Rat   153 TTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIADVPLETEDLTNWLYQRFIEKEDLLSHFYK 217

  Fly   306 TGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAV------FSLSCIFYYVI 349
            ||:|....|.||..:     |..:|.|  .|.:      |....::|:||
  Rat   218 TGAFPPPQGQKEAVS-----RAMTLSN--VWILLIQSFAFLSGYLWYHVI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 57/245 (23%)
LPLAT_LCLAT1-like 75..271 CDD:153252 33/159 (21%)
Acyltransf_C 258..336 CDD:292694 22/77 (29%)
LOC317456NP_001041359.1 LPLAT_LCLAT1-like <17..183 CDD:153252 33/159 (21%)
Acyltransf_C 172..>228 CDD:292694 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.