DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Tmem68

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001101373.1 Gene:Tmem68 / 312946 RGDID:1309006 Length:329 Species:Rattus norvegicus


Alignment Length:188 Identity:39/188 - (20%)
Similarity:65/188 - (34%) Gaps:72/188 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAI-RYVPIIGWGWWLAEFVFLNRNFDQDKTII 168
            |:.:..|.|.|             ||.|.:|:.|| ..||||                    .:.
  Rat   203 LLSDETYNIIW-------------GNRKGFAQVAIDAKVPII--------------------PMF 234

  Fly   169 TEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRG 233
            |:.::..|.         :..|||.        .|:..|:    .::...|...||...|....|
  Rat   235 TQNIREGFR---------SLGGTRL--------FKWLYEK----FRYPFAPMYGGFPVKLRTFLG 278

  Fly   234 LCPVIYDINL-AYRPTDKTPATMLSLLHGKSVEPHLLMRRIP-------LEQVPEDEK 283
             .|:.||..: |....:||...:.:|     ::.|   :|||       |::..:::|
  Rat   279 -DPIPYDPEVTAEELAEKTKNAVQAL-----IDKH---QRIPGNIRSALLDRFHKEQK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 39/188 (21%)
LPLAT_LCLAT1-like 75..271 CDD:153252 34/167 (20%)
Acyltransf_C 258..336 CDD:292694 7/33 (21%)
Tmem68NP_001101373.1 LPLAT_MGAT-like 103..309 CDD:153249 34/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.