DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat2

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001101291.1 Gene:Agpat2 / 311821 RGDID:1309229 Length:278 Species:Rattus norvegicus


Alignment Length:249 Identity:55/249 - (22%)
Similarity:89/249 - (35%) Gaps:87/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVIKMGSLEKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQ 72
            |.:|:|       |..: ||::.:...|.:|     ||.|.. :.:|.                 
  Rat    26 FYVKVG-------LYCV-LCLSFSAAASIVC-----LLRHGG-RTVDN----------------- 59

  Fly    73 LIFVSDWYAGSKMTVYMDKEDFEKHAGKE-----HVLLIMNHKYEIDWLNGWMICEKLGVLGNCK 132
             :.:..|:..|...||..:  ||....|:     ..::|.||:..:|.:....|..|     .|.
  Rat    60 -MSIISWFVRSFKYVYGLR--FEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPK-----RCV 116

  Fly   133 AYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKT-----------IITEQLKVVFSYPDPTWLLL 186
            ..||:.:.:...:|...:|....|:||  .|.||           ::.|.|| |:.||       
  Rat   117 QIAKRELMFTGPVGLIMYLGGVYFINR--QQAKTAMSLMADLGDLMVKENLK-VWIYP------- 171

  Fly   187 NAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKG-FTASLAPIRGLCPVIY 239
              ||||             .:.|      .|:|..|| |..::.....:.||:|
  Rat   172 --EGTR-------------NDNG------DLLPFKKGAFYLAIQAQVPIIPVVY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 51/234 (22%)
LPLAT_LCLAT1-like 75..271 CDD:153252 43/182 (24%)
Acyltransf_C 258..336 CDD:292694
Agpat2NP_001101291.1 LPLAT_AGPAT-like 67..240 CDD:153251 42/176 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.