DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Agpat5

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_017455638.1 Gene:Agpat5 / 306582 RGDID:1306405 Length:365 Species:Rattus norvegicus


Alignment Length:266 Identity:68/266 - (25%)
Similarity:130/266 - (48%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IDKRLFRKLMYYACYSLYSQLI-FVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWL 116
            :|.||         |.:|..:: |..:.|.|.::.:|   .|..|:  ||:|:.:.||:..:||:
  Rat    50 VDDRL---------YCVYQNMVLFFFENYTGVQILLY---GDLPKN--KENVIYLANHQSTVDWI 100

  Fly   117 NGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEF--VFLNRNFDQDKTIITEQLKVVFSYP 179
            ...|:..:...||:.:...|..::::|:  :|::.|:.  :::.|:...:...:..:|:...:..
  Rat   101 VADMLAARQDALGHVRYVLKDGLKWLPL--YGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG 163

  Fly   180 DPTWLLLNAEGTRFTPAKHE---ASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDI 241
            .|.:|::..||||:.....:   ||..||.:||:.||||.|.||.|....:...::.....|||:
  Rat   164 TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDV 228

  Fly   242 NLAYRPTDK------TPATMLSLLHGKSVEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDKII 300
            .:.|...:|      .|.:|...|..:....|:...||..::|||:::....||...|..|||::
  Rat   229 TVVYEGNEKNSGKYSNPPSMTEFLCKQCPRLHIHFDRIDRKEVPEEQEHMKKWLHERFEIKDKLL 293

  Fly   301 DSFLET 306
            ..|.::
  Rat   294 VEFYDS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 68/266 (26%)
LPLAT_LCLAT1-like 75..271 CDD:153252 51/206 (25%)
Acyltransf_C 258..336 CDD:292694 14/49 (29%)
Agpat5XP_017455638.1 LPLAT_LCLAT1-like 63..264 CDD:153252 51/207 (25%)
Acyltransf_C 251..320 CDD:406475 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51956
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.