DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Gpat3

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001020841.1 Gene:Gpat3 / 305166 RGDID:1565703 Length:457 Species:Rattus norvegicus


Alignment Length:116 Identity:24/116 - (20%)
Similarity:47/116 - (40%) Gaps:29/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TVYMDKEDFEKHAGKEHVLLIMNHKYEIDWL----NGWMICEKL------GVLGNCKAYAKKAIR 140
            |::...:.:....|.   :.:.||...||.|    :|   |..:      |::|..:....||..
  Rat   209 TIHYHNKQYRPQKGG---ICVANHTSPIDVLILATDG---CYAMVGQVHGGLMGIIQRAMVKACP 267

  Fly   141 YVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGT 191
            :|      |:       .|:..:|:.::|::||...:......:|:..|||
  Rat   268 HV------WF-------ERSEIKDRHLVTKRLKEHIADKKKLPILIFPEGT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 24/116 (21%)
LPLAT_LCLAT1-like 75..271 CDD:153252 24/116 (21%)
Acyltransf_C 258..336 CDD:292694
Gpat3NP_001020841.1 LPLAT_LPCAT1-like 199..408 CDD:153253 24/116 (21%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 229..234 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.