DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and Lpcat2

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_766602.1 Gene:Lpcat2 / 270084 MGIID:3606214 Length:544 Species:Mus musculus


Alignment Length:44 Identity:13/44 - (29%)
Similarity:23/44 - (52%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VLLIMNHKYE-IDWL-NGWMICEKLGVLGNCKAYAKKAIRYVPI 144
            |||...:|.: :.|. .|:...: |.||..|:.:.|..|.::|:
Mouse   246 VLLRYPNKLDTVTWTWQGYTFLQ-LCVLTFCQLFTKVEIEFMPV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 13/44 (30%)
LPLAT_LCLAT1-like 75..271 CDD:153252 13/44 (30%)
Acyltransf_C 258..336 CDD:292694
Lpcat2NP_766602.1 PlsC 69..>254 CDD:223282 3/7 (43%)
LPLAT_LPCAT1-like 115..327 CDD:153253 13/44 (30%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 146..151
EGTC motif 220..223
EFh 396..458 CDD:238008
EF-hand_7 396..457 CDD:290234
EF-hand_7 433..489 CDD:290234
EFh 433..486 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..544
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.