DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and LPCAT4

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_705841.2 Gene:LPCAT4 / 254531 HGNCID:30059 Length:524 Species:Homo sapiens


Alignment Length:151 Identity:34/151 - (22%)
Similarity:48/151 - (31%) Gaps:59/151 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GVLGNCKAYAK--------------KAIRY---VPIIGWGW---------WLAEFVFLNRNFDQD 164
            |...|.||..|              ..|||   :....|.|         ||..        .|.
Human   204 GTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTA--------SQP 260

  Fly   165 KTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVK--FAQERGMTVLKHHLIPRTK-GFTA 226
            .:|:..:...|: :|.|       |.:| .|..:..:|:  .||..|        ||.|: .|..
Human   261 CSIVDVEFLPVY-HPSP-------EESR-DPTLYANNVQRVMAQALG--------IPATECEFVG 308

  Fly   227 SLAPIRGLCPVIYDINLAYRP 247
            ||..|     |:..:.:|..|
Human   309 SLPVI-----VVGRLKVALEP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 34/151 (23%)
LPLAT_LCLAT1-like 75..271 CDD:153252 34/151 (23%)
Acyltransf_C 258..336 CDD:292694
LPCAT4NP_705841.2 LPLAT_LPCAT1-like 109..306 CDD:153253 27/126 (21%)
HXXXXD motif 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.