DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and LCLAT1

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_872357.2 Gene:LCLAT1 / 253558 HGNCID:26756 Length:414 Species:Homo sapiens


Alignment Length:268 Identity:70/268 - (26%)
Similarity:124/268 - (46%) Gaps:11/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDK 165
            |..::||||:..:||:..|....:...|...|...|.:::.||..||....|.::|::|.:..||
Human   115 ERSVIIMNHRTRMDWMFLWNCLMRYSYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDK 179

  Fly   166 TIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAP 230
            :...:.:.......:|..||:..|||..|......|..||::.|:...::.|.|||.|||..:..
Human   180 SHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDR 244

  Fly   231 IR--GLCPVIYDINLAYRPTDKTPATMLSLLHGK-SVEPHLLMRRIPLEQVPEDEKEAAAWLQNL 292
            :|  .....::||.:||  ....|.:...||.|. ..|.|..:.|.|::.:|..:::...|....
Human   245 LREGKNLDAVHDITVAY--PHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR 307

  Fly   293 FVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRR--LCSLVNFVCWAVFS-LSCIFYYVITSLLA 354
            :.||::.:.||.:....|..:|...:|...::.|  :..|::.:.|.:|| ..|:..|:.:   .
Human   308 WEEKEERLRSFYQGEKNFYFTGQSVIPPCKSELRVLVVKLLSILYWTLFSPAMCLLIYLYS---L 369

  Fly   355 ANWTAFIT 362
            ..|...||
Human   370 VKWYFIIT 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 70/268 (26%)
LPLAT_LCLAT1-like 75..271 CDD:153252 49/172 (28%)
Acyltransf_C 258..336 CDD:292694 18/80 (23%)
LCLAT1NP_872357.2 PRK14014 45..324 CDD:237584 57/210 (27%)
LPLAT_LCLAT1-like 93..286 CDD:153252 49/172 (28%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 123..128 1/4 (25%)
Acyltransf_C 272..344 CDD:292694 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3473
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.