DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and acl-2

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001256175.1 Gene:acl-2 / 179398 WormBaseID:WBGene00011543 Length:282 Species:Caenorhabditis elegans


Alignment Length:266 Identity:60/266 - (22%)
Similarity:100/266 - (37%) Gaps:83/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLCIALTFFTSGLCINFIQLLMH---VFIKPIDKRLFRKLMYYACYSLYSQLIFVSDW--YAGSK 84
            |..:.::|:       :..:|:|   |.:..|...|..|...|..:|.:.       |  :.|..
 Worm    27 HYYMRISFY-------YFTILLHGMEVCVTMIPSWLNGKGADYVFHSFFY-------WCKWTGVH 77

  Fly    85 MTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGW 149
            .|||    .:||...:...::|.||:..:|.|:...|..|     ||....|:.:.|||....|.
 Worm    78 TTVY----GYEKTQVEGPAVVICNHQSSLDILSMASIWPK-----NCVVMMKRILAYVPFFNLGA 133

  Fly   150 WLAEFVFLNRNFDQDKTIIT----------EQLKVVFSYPDPTWLLLNAEGTR-----FTPAKHE 199
            :.:..:|::| :::::.:.:          ..||:        |:.  .||||     |.|.|..
 Worm   134 YFSNTIFIDR-YNRERAMASVDYCASEMKNRNLKL--------WVF--PEGTRNREGGFIPFKKG 187

  Fly   200 A------------SVKFAQER-------------GMTVLK-HHLIPRTKGFTASLAPIRGLCPVI 238
            |            .|.|:..|             |..|:: ...|| |||.|  |..:..|..:.
 Worm   188 AFNIAVRAQIPIIPVVFSDYRDFYSKPGRYFKNDGEVVIRVLDAIP-TKGLT--LDDVSELSDMC 249

  Fly   239 YDINLA 244
            .|:.||
 Worm   250 RDVMLA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 60/266 (23%)
LPLAT_LCLAT1-like 75..271 CDD:153252 50/213 (23%)
Acyltransf_C 258..336 CDD:292694
acl-2NP_001256175.1 PlsC 62..282 CDD:223282 52/224 (23%)
LPLAT_AGPAT-like 70..250 CDD:153251 47/202 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.