DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat3 and acl-9

DIOPT Version :9

Sequence 1:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_504644.1 Gene:acl-9 / 179032 WormBaseID:WBGene00022646 Length:399 Species:Caenorhabditis elegans


Alignment Length:369 Identity:93/369 - (25%)
Similarity:162/369 - (43%) Gaps:87/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFV--------SDWYAGSKMTVY 88
            ||  |:......|::.:|:||   ||:|:::        .:|:.:        .::..|:.:.: 
 Worm    34 FF--GVLYIVTPLVVLLFLKP---RLWRQML--------DRLVGIWVIMPGALCNYIFGANIRI- 84

  Fly    89 MDKEDFEKHAGKEHVLLIMNHKYEIDWLNGW--------MIC--EKLGVLGNCKAYAKKAIRYVP 143
              |.||..|  :|..|:||||:..:|||..|        .:|  ||:.:.|        .::|||
 Worm    85 --KGDFINH--EEPALIIMNHRTRLDWLFFWNALYKMDPWLCTTEKISLKG--------MLKYVP 137

  Fly   144 IIGWGWWLAEFVFLNRNFDQDKT----IITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKF 204
            ..||....|.::||:|:||.|||    |:....:..:.|.    |||..|||...|...|.|...
 Worm   138 GAGWAMQAASYIFLDRSFDTDKTKLDNILNYYAETEYKYQ----LLLFPEGTDKCPKATERSRIH 198

  Fly   205 AQERGMTVLKHHLIPRTKGFTASLAPIRGLCPV--IYDINLAYRPTDKTPATMLSLL-HG---KS 263
            ::::|:...::.|.||..||...:..:|....:  |||:::.:  .|....:.|.:. ||   |.
 Worm   199 SEKKGLVHYQYVLHPRVTGFVHIVQAMRRANNIKYIYDVSIGF--GDAIVQSELDIFAHGVCPKE 261

  Fly   264 VEPHLLMRRIPLEQVPEDEKEAAAWLQNLFVEKDKIIDSFLE----TGSFFKT-SGIKEVPAYVN 323
            |...::  :.|:|.:|:.::....||.||:..|::.:..|.|    ...|..| .|::.......
 Worm   262 VFYQVI--KYPIEAIPQTDEALGQWLVNLWRNKEEKLKRFYEMPRNVRQFPDTPDGVEYELDNNT 324

  Fly   324 KRRLCSLVNFVC------------------WAVFSLSCIFYYVI 349
            .|....|:.|.|                  ||:  ::|:||..:
 Worm   325 DRAQKGLIGFWCFTTVFWMFMFFESAFMFYWAI--IACVFYAAV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 93/369 (25%)
LPLAT_LCLAT1-like 75..271 CDD:153252 60/223 (27%)
Acyltransf_C 258..336 CDD:292694 21/104 (20%)
acl-9NP_504644.1 LPLAT_LCLAT1-like 72..264 CDD:153252 60/210 (29%)
Acyltransf_C 258..>301 CDD:374349 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6285
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3462
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4847
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3473
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.